PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10000643m
Common NameCARUB_v10000643mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 546aa    MW: 60872 Da    PI: 6.7164
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10000643mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-1875121148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av+++ g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Carubv10000643m  75 KGGWTPEEDETLRRAVEKYKGKRWKKIAEFFP-DRTEVQCLHRWQKVL 121
                      688*****************************.************986 PP

2Myb_DNA-binding61.91.3e-19127173148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++vk++G+  W+ Ia+ ++ gR +kqc++rw+++l
  Carubv10000643m 127 KGPWTQEEDDKIVELVKKYGPAKWSVIAKSLP-GRIGKQCRERWHNHL 173
                      79******************************.*************97 PP

3Myb_DNA-binding51.22.9e-16179222146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE+  l +a++ +G++ W+ Ia+ ++ gRt++ +k++w++
  Carubv10000643m 179 KDAWTIEEESALMNAHRIYGNK-WAEIAKVLP-GRTDNAIKNHWNS 222
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.85670121IPR017930Myb domain
SMARTSM007175.7E-1774123IPR001005SANT/Myb domain
PfamPF002497.5E-1775121IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-1676131IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-2477129IPR009057Homeodomain-like
CDDcd001674.31E-1578121No hitNo description
PROSITE profilePS5129431.779122177IPR017930Myb domain
SuperFamilySSF466895.99E-32124220IPR009057Homeodomain-like
SMARTSM007173.9E-18126175IPR001005SANT/Myb domain
PfamPF002492.3E-18127173IPR001005SANT/Myb domain
CDDcd001671.54E-15129173No hitNo description
Gene3DG3DSA:1.10.10.602.0E-27130176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-23177228IPR009057Homeodomain-like
PROSITE profilePS5129422.361178228IPR017930Myb domain
SMARTSM007171.4E-14178226IPR001005SANT/Myb domain
PfamPF002492.3E-14179222IPR001005SANT/Myb domain
CDDcd001673.18E-11181224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MSSSSNPAAC YPVKEELSEL QTEIQCMENK QPLAASCSSA SEGSGCFFLK SPEIATPATS  60
SPTPRRTSGP MRRAKGGWTP EEDETLRRAV EKYKGKRWKK IAEFFPDRTE VQCLHRWQKV  120
LNPELVKGPW TQEEDDKIVE LVKKYGPAKW SVIAKSLPGR IGKQCRERWH NHLNPDIRKD  180
AWTIEEESAL MNAHRIYGNK WAEIAKVLPG RTDNAIKNHW NSSLKKKLEF YLATGNLPPP  240
ATKFSVLNDI ADGDRDSKQS SATKPFKDSD SVAQTSSGNT DSNEVGKDHI DASSALLEEV  300
AASRRISVNE YACSPVEHKP RLPNLEPISE EVRINSRAYV ERSIQRKEEN GFGTPKHGNL  360
YYKSPLDYYF PSEADLQRMY GSECGCSPES ATPVSLITPP CNKDSGLAAT RSPESFLREA  420
ARTFPNTPSI FRKRRKVVLA AKTDDDAVVN VGVKEAEQKE ESKDSSDISP AGRESLLLET  480
TDDCRDDEKL ESNGNVINVS PPYRLRAKRT AGMKSRQLEF TSAKENQPDN ETETSELASE  540
EDKPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-72742285159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-72742285159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196490.0AY519649.1 Arabidopsis thaliana MYB transcription factor (At5g02320) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287439.10.0hypothetical protein CARUB_v10000643mg
TrEMBLR0FDT20.0R0FDT2_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_60001240.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.20.0myb domain protein 3r-5